|
|
|
|
|
|
|
| Information on 1qnr_A_161 |
|
Loop code: 1qnr_A_161 PDB: 1qnr Chain: A Type: EH beta-alpha |
Loop Start: 161 Loop Length: 12 Sec Struct Nt length: 5 Sec Struct Ct length: 17 Structure geometry
|
| Sequence: | IFAWELGNEPRCNGCSTDVIVQWATSVSQYVKSL |
| Sec Struct: | EEEEES-BS---TT--THHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | N - 168 | 0 | 1 |
| MABMANNOBIOSE | N - 168 | 0 | 1 |
| GOLGLYCEROL | E - 169 | 0 | 1 |
| MABMANNOBIOSE | E - 169 | 0 | 1 |
| MABMANNOBIOSE | R - 171 | 0 | 1 |
| NAGN-ACETYL-D-GLUCOSAMINE | L - 194 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| MAN - MANNAN BINDING SITE | E - 169 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|