|
|
|
|
|
|
|
| Information on 1iex_A_142 |
|
Loop code: 1iex_A_142 PDB: 1iex Chain: A Type: EH beta-alpha |
Loop Start: 142 Loop Length: 23 Sec Struct Nt length: 2 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | YAFAPCIAVCRDPRWGRCYESYSEDRRIVQS |
| Sec Struct: | EE---B------TTSTTGGGSS-SSHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| TCBTHIOCELLOBIOSE | F - 144 | 0 | 1 |
| TCBTHIOCELLOBIOSE | R - 158 | 0 | 1 |
| TCBTHIOCELLOBIOSE | E - 161 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|