|
|
|
|
|
|
|
| Information on 7req_A_327 |
|
Loop code: 7req_A_327 PDB: 7req Chain: A Type: EH beta-alpha |
Loop Start: 327 Loop Length: 11 Sec Struct Nt length: 5 Sec Struct Ct length: 15 Structure geometry
|
| Sequence: | THSQTSGWSLTAQDVYNNVVRTCIEAMAATQ |
| Sec Struct: | EEEEE-STT--SSSTTHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| 2CP2-CARBOXYPROPYL-COENZYME A | T - 327 | 1 | 0 |
| 2CP2-CARBOXYPROPYL-COENZYME A | H - 328 | 1 | 0 |
| 2CP2-CARBOXYPROPYL-COENZYME A | Q - 330 | 0 | 1 |
| B12COBALAMIN | G - 333 | 0 | 1 |
| B12COBALAMIN | W - 334 | 0 | 1 |
| B12COBALAMIN | S - 335 | 0 | 1 |
| B12COBALAMIN | L - 336 | 0 | 1 |
| B12COBALAMIN | T - 337 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|