|
|
|
|
|
|
|
| Information on 1px0_A_126 |
|
Loop code: 1px0_A_126 PDB: 1px0 Chain: A Type: EH beta-alpha |
Loop Start: 126 Loop Length: 12 Sec Struct Nt length: 5 Sec Struct Ct length: 21 Structure geometry
|
| Sequence: | HIIFITSATPFGPWKELSTYTSARAGACTLANALSKEL |
| Sec Struct: | EEEEE--SGGGS--TT-HHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| RPN(R)-1-PARA-NITRO-PHENYL-2-AZIDO-ETHANOL | T - 131 | 0 | 1 |
| RPN(R)-1-PARA-NITRO-PHENYL-2-AZIDO-ETHANOL | S - 132 | 0 | 1 |
| RPN(R)-1-PARA-NITRO-PHENYL-2-AZIDO-ETHANOL | A - 133 | 0 | 1 |
| RPN(R)-1-PARA-NITRO-PHENYL-2-AZIDO-ETHANOL | T - 134 | 0 | 1 |
| RPN(R)-1-PARA-NITRO-PHENYL-2-AZIDO-ETHANOL | W - 139 | 0 | 1 |
| RPN(R)-1-PARA-NITRO-PHENYL-2-AZIDO-ETHANOL | L - 142 | 0 | 1 |
| RPN(R)-1-PARA-NITRO-PHENYL-2-AZIDO-ETHANOL | Y - 145 | 1 | 0 |
| RPN(R)-1-PARA-NITRO-PHENYL-2-AZIDO-ETHANOL | R - 149 | 1 | 0 |
| Associated ArchDB40 Subclass to 1px0_A_126 |
| Associated ArchDB95 Subclass to 1px0_A_126 |
| For any comment or web-related incidence, send an email to the webmaster. |
|