|
|
|
|
|
|
|
| Information on 1ixk_A_235 |
|
Loop code: 1ixk_A_235 PDB: 1ixk Chain: A Type: EH beta-alpha |
Loop Start: 235 Loop Length: 8 Sec Struct Nt length: 12 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | VLKPGGILVYSTCSLEPEENEFVIQWALDN |
| Sec Struct: | HEEEEEEEEEEES---GGGTHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | V - 235 | 1 | 0 |
| MSESELENOMETHIONINE | L - 242 | 1 | 0 |
| MSESELENOMETHIONINE | Y - 244 | 1 | 0 |
| MSESELENOMETHIONINE | L - 249 | 0 | 1 |
| MSESELENOMETHIONINE | E - 250 | 0 | 1 |
| MSESELENOMETHIONINE | E - 252 | 0 | 1 |
| MSESELENOMETHIONINE | V - 257 | 1 | 0 |
| MSESELENOMETHIONINE | W - 260 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|