|
|
|
|
|
|
|
| Information on 1nw6_A_207 |
|
Loop code: 1nw6_A_207 PDB: 1nw6 Chain: A Type: EH beta-alpha |
Loop Start: 207 Loop Length: 19 Sec Struct Nt length: 3 Sec Struct Ct length: 11 Structure geometry
|
| Sequence: | VWRMSRLNGNSLERVGHPTQKPAAVIERLVRAL |
| Sec Struct: | EEE-----TT-TT--S-TT---HHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| SFGADENOSYL-ORNITHINE | H - 223 | 0 | 1 |
| SFGADENOSYL-ORNITHINE | P - 224 | 0 | 1 |
| SFGADENOSYL-ORNITHINE | T - 225 | 0 | 1 |
| SFGADENOSYL-ORNITHINE | K - 227 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|