|
|
|
|
|
|
|
| Information on 1ex0_A_488 |
|
Loop code: 1ex0_A_488 PDB: 1ex0 Chain: A Type: HE alpha-beta |
Loop Start: 488 Loop Length: 14 Sec Struct Nt length: 11 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | EEERLALETALMYGAKKPLNTSRSNVDMDFEV |
| Sec Struct: | HHHHHHHHHHHTTT-B--S------EEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | E - 490 | 1 | 0 |
| PGO1,2-PROPANEDIOL | T - 496 | 1 | 0 |
| PGO1,2-PROPANEDIOL | Y - 500 | 0 | 1 |
| CACALCIUM ION | K - 504 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|