Logo
Information on 1kjw_A_491
Loop code: 1kjw_A_491
PDB: 1kjw
Chain: A
Type: HE alpha-beta
Loop Start: 491  Loop Length: 20
Sec Struct Nt length: 9  Sec Struct Ct length: 8
Structure geometry
d (Å): 17.320499 delta (°): 138.880295theta (°): 150.876297 rho (°): 142.705704
Sequence:KRRVERREWSRLKWGSSSGSQGREDSVLSYETVTQME
Sec Struct:HHHHHHHHHTS----S--SS---------EEEEEEEE