Logo
Information on 1o4u_A_84
Loop code: 1o4u_A_84
PDB: 1o4u
Chain: A
Type: HE alpha-beta
Loop Start: 84  Loop Length: 5
Sec Struct Nt length: 30  Sec Struct Ct length: 3
Structure geometry
d (Å): 8.763400 delta (°): 87.519798theta (°): 158.434494 rho (°): 30.510300
Sequence:TYKLLVAERTLLNVLSVMFSVATTTRRFAEKLKHAKIA
Sec Struct:HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT-SSSEEE