Logo
Information on 1pn0_A_191
Loop code: 1pn0_A_191
PDB: 1pn0
Chain: A
Type: HE alpha-beta
Loop Start: 191  Loop Length: 13
Sec Struct Nt length: 9  Sec Struct Ct length: 11
Structure geometry
d (Å): 20.229799 delta (°): 37.026600theta (°): 108.598297 rho (°): 91.723297
Sequence:NLQTQEEEDANYRLPEGKEAGEIETVHCKYVIG
Sec Struct:HHHHHHHHHTS---STT--TT-EEEEEEEEEEE