Logo
Information on 1mwm_A_243
Loop code: 1mwm_A_243
PDB: 1mwm
Chain: A
Type: HE alpha-beta
Loop Start: 243  Loop Length: 7
Sec Struct Nt length: 25  Sec Struct Ct length: 5
Structure geometry
d (Å): 13.974600 delta (°): 75.039001theta (°): 148.771896 rho (°): 351.102692
Sequence:NKISIVTEAMNEALRKLEQRVLNTLNEFSGYTHVMVI
Sec Struct:HHHHHHHHHHHHHHHHHHHHHHHHHTT--S--EEEEE