Logo
Information on 1nt4_A_156
Loop code: 1nt4_A_156
PDB: 1nt4
Chain: A
Type: HE alpha-beta
Loop Start: 156  Loop Length: 21
Sec Struct Nt length: 11  Sec Struct Ct length: 3
Structure geometry
d (Å): 23.460100 delta (°): 131.217194theta (°): 103.170197 rho (°): 38.815300
Sequence:TDSYQLLEKIVNYKDSPACKEKQQCSLVDGKNTFS
Sec Struct:HHHHHHHHHHHTGGGSTTTTTT----TTT---EEE