Logo
Information on 1p9y_A_51
Loop code: 1p9y_A_51
PDB: 1p9y
Chain: A
Type: HE alpha-beta
Loop Start: 51  Loop Length: 5
Sec Struct Nt length: 31  Sec Struct Ct length: 8
Structure geometry
d (Å): 15.199200 delta (°): 98.373199theta (°): 176.174500 rho (°): 298.729401
Sequence:MNIVAQRYGASVRQDVLGDLMSRNFIDAIIKEKINPAGAPTYVP
Sec Struct:HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT---EEEEEEEE