Logo
Information on 1jih_A_188
Loop code: 1jih_A_188
PDB: 1jih
Chain: A
Type: HE alpha-beta
Loop Start: 188  Loop Length: 23
Sec Struct Nt length: 9  Sec Struct Ct length: 2
Structure geometry
d (Å): 33.502701 delta (°): 138.042099theta (°): 83.280800 rho (°): 1.386400
Sequence:SNIREAFIGGNYDINSHLPLIPEKIKSLKFEGDV
Sec Struct:HHHHHHHHH--S-TTSB-----GGGGG----SEE