Logo
Information on 1nnh_A_126
Loop code: 1nnh_A_126
PDB: 1nnh
Chain: A
Type: HE alpha-beta
Loop Start: 126  Loop Length: 10
Sec Struct Nt length: 23  Sec Struct Ct length: 4
Structure geometry
d (Å): 26.109600 delta (°): 151.246796theta (°): 120.695396 rho (°): 28.458401
Sequence:MEDIMRLIERLVYGLFRKAEEWTGREFPKTKRFEVFE
Sec Struct:HHHHHHHHHHHHHHHHHHHHHHHSS-----SS-EEEE