|
|
|
|
|
|
|
| Information on 1k4i_A_71 |
|
Loop code: 1k4i_A_71 PDB: 1k4i Chain: A Type: HE alpha-beta |
Loop Start: 71 Loop Length: 21 Sec Struct Nt length: 6 Sec Struct Ct length: 3 Structure geometry
|
| Sequence: | PERTTALDLPQMVTHNADPRGTAYTVSVDA |
| Sec Struct: | HHHHHHTT--BS-SS---SS---BB--EEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| SULSULFATE ANION | Q - 81 | 0 | 1 |
| SULSULFATE ANION | V - 83 | 0 | 1 |
| SULSULFATE ANION | T - 84 | 0 | 1 |
| SULSULFATE ANION | D - 88 | 0 | 1 |
| MGMAGNESIUM ION | R - 90 | 0 | 1 |
| SULSULFATE ANION | R - 90 | 0 | 1 |
| MGMAGNESIUM ION | T - 92 | 0 | 1 |
| SULSULFATE ANION | T - 92 | 0 | 1 |
| MGMAGNESIUM ION | Y - 94 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|