|
|
|
|
|
|
|
| Information on 1uuh_A_46 |
|
Loop code: 1uuh_A_46 PDB: 1uuh Chain: A Type: HE alpha-beta |
Loop Start: 46 Loop Length: 22 Sec Struct Nt length: 10 Sec Struct Ct length: 3 Structure geometry
|
| Sequence: | RTEAADLCKAFNSTLPTAQEKALSIGFETCRYGFI |
| Sec Struct: | HHHHHHHHHHTT-B------TTGGGT---SS-EEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | P - 61 | 0 | 1 |
| MSESELENOMETHIONINE | T - 62 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|