|
|
|
|
|
|
|
| Information on 2por_*_208 |
|
Loop code: 2por_*_208 PDB: 2por Chain: * Type: HE alpha-beta |
Loop Start: 208 Loop Length: 11 Sec Struct Nt length: 7 Sec Struct Ct length: 15 Structure geometry
|
| Sequence: | RDFARAVFDLTPVAAAATAVDHKAYGLSVDSTF |
| Sec Struct: | HHHHHHHTT----SS---EEEEEEEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| OTE2-{2-[2-(2-OCTYLOXY-ETHOXY)-ETHOXYL]-ETHOXY}ETHANOL | F - 210 | 1 | 0 |
| OTE2-{2-[2-(2-OCTYLOXY-ETHOXY)-ETHOXYL]-ETHOXY}ETHANOL | V - 214 | 0 | 1 |
| OTE2-{2-[2-(2-OCTYLOXY-ETHOXY)-ETHOXYL]-ETHOXY}ETHANOL | F - 215 | 0 | 1 |
| OTE2-{2-[2-(2-OCTYLOXY-ETHOXY)-ETHOXYL]-ETHOXY}ETHANOL | D - 216 | 0 | 1 |
| OTE2-{2-[2-(2-OCTYLOXY-ETHOXY)-ETHOXYL]-ETHOXY}ETHANOL | H - 229 | 1 | 0 |
| OTE2-{2-[2-(2-OCTYLOXY-ETHOXY)-ETHOXYL]-ETHOXY}ETHANOL | Y - 232 | 1 | 0 |
| OTE2-{2-[2-(2-OCTYLOXY-ETHOXY)-ETHOXYL]-ETHOXY}ETHANOL | G - 233 | 1 | 0 |
| OTE2-{2-[2-(2-OCTYLOXY-ETHOXY)-ETHOXYL]-ETHOXY}ETHANOL | L - 234 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|