Logo
Information on 1hf8_A_115
Loop code: 1hf8_A_115
PDB: 1hf8
Chain: A
Type: HH alpha-alpha
Loop Start: 115  Loop Length: 19
Sec Struct Nt length: 27  Sec Struct Ct length: 19
Structure geometry
d (Å): 14.568700 delta (°): 54.081501theta (°): 169.567200 rho (°): 303.965607
Sequence:LQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALL
Sec Struct:HHHHHHHHHHHHHHHHHHHHHHHHHHHSS-TTTS--SSSSTTTS--HHHHHHHHHHHHHHHHHHH