Logo
Information on 1i1r_B_9
Loop code: 1i1r_B_9
PDB: 1i1r
Chain: B
Type: HH alpha-alpha
Loop Start: 9  Loop Length: 32
Sec Struct Nt length: 26  Sec Struct Ct length: 26
Structure geometry
d (Å): 40.184898 delta (°): 153.924194theta (°): 40.044800 rho (°): 317.098694
Sequence:KDLLIQRLNWMLWVIDECFRDLCYRTGICKGILEPAAIFHLKLPAINDTDHCGLIGFNETSCLKKLADGFFEFEVLFKFLTTEF
Sec Struct:HHHHHHHHHHHHHHHHHHHHHHHHHH--BTTTB---S---S------STT--SSSS--HHHHHHHHHHHHHHHHHHHHHHHHHH