Logo
Information on 1iq0_A_470
Loop code: 1iq0_A_470
PDB: 1iq0
Chain: A
Type: HH alpha-alpha
Loop Start: 470  Loop Length: 12
Sec Struct Nt length: 18  Sec Struct Ct length: 10
Structure geometry
d (Å): 22.985300 delta (°): 118.875603theta (°): 122.147003 rho (°): 214.633499
Sequence:GPYVQYAHARAHSILRKAGEWGAPDLSQATPYERALALDL
Sec Struct:HHHHHHHHHHHHHHHHHH-------GGG--HHHHHHHHHH