|
|
|
|
|
|
|
| Information on 1aui_B_108 |
|
Loop code: 1aui_B_108 PDB: 1aui Chain: B Type: HH alpha-alpha |
Loop Start: 108 Loop Length: 5 Sec Struct Nt length: 12 Sec Struct Ct length: 15 Structure geometry
|
| Sequence: | NGELFQVLKMMVGNNLKDTQLQQIVDKTIINA |
| Sec Struct: | HHHHHHHHHHHHTTSS-HHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | E - 110 | 1 | 0 |
| CACALCIUM ION | A - 139 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| CA3CALCIUM BINDING SITE. | E - 110 | 1 | 0 |
| Associated ArchDB40 Subclass to 1aui_B_108 |
| Associated ArchDB95 Subclass to 1aui_B_108 |
| For any comment or web-related incidence, send an email to the webmaster. |
|