|
|
|
|
|
|
|
| Information on 1ooh_A_42 |
|
Loop code: 1ooh_A_42 PDB: 1ooh Chain: A Type: HH alpha-alpha |
Loop Start: 42 Loop Length: 10 Sec Struct Nt length: 14 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | QDLMCYTKCVSLMAGTVNKKGEFNAPKALAQ |
| Sec Struct: | HHHHHHHHHHHHHHTSB-TT--B-HHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| 1BO1-BUTANOL | T - 48 | 1 | 0 |
| 1BO1-BUTANOL | V - 51 | 1 | 0 |
| 1BO1-BUTANOL | S - 52 | 1 | 0 |
| 1BO1-BUTANOL | A - 55 | 0 | 1 |
| 1BO1-BUTANOL | G - 56 | 0 | 1 |
| 1BO1-BUTANOL | T - 57 | 0 | 1 |
| 1BO1-BUTANOL | V - 58 | 0 | 1 |
| 1BO1-BUTANOL | F - 64 | 0 | 1 |
| Associated ArchDB40 Subclass to 1ooh_A_42 |
| Associated ArchDB95 Subclass to 1ooh_A_42 |
| For any comment or web-related incidence, send an email to the webmaster. |
|