Logo
Information on 1owf_B_3
Loop code: 1owf_B_3
PDB: 1owf
Chain: B
Type: HH alpha-alpha
Loop Start: 3  Loop Length: 5
Sec Struct Nt length: 11  Sec Struct Ct length: 20
Structure geometry
d (Å): 9.968800 delta (°): 107.796600theta (°): 135.950500 rho (°): 348.526215
Sequence:KSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLA
Sec Struct:HHHHHHHHHHH-TTS-HHHHHHHHHHHHHHHHHHHH