Logo
Information on 1f44_A_111
Loop code: 1f44_A_111
PDB: 1f44
Chain: A
Type: HH alpha-alpha
Loop Start: 111  Loop Length: 12
Sec Struct Nt length: 16  Sec Struct Ct length: 11
Structure geometry
d (Å): 31.982401 delta (°): 59.967999theta (°): 65.742699 rho (°): 39.422901
Sequence:NAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLM
Sec Struct:HHHHHHHHHHHHHHHHTT----------HHHHHHHHHHH