Logo
Information on 1gzs_B_104
Loop code: 1gzs_B_104
PDB: 1gzs
Chain: B
Type: HH alpha-alpha
Loop Start: 104  Loop Length: 5
Sec Struct Nt length: 29  Sec Struct Ct length: 13
Structure geometry
d (Å): 9.581000 delta (°): 123.110901theta (°): 163.447693 rho (°): 44.470100
Sequence:PAYASQTREAILSAVYSKNKDQCCNLLISKGINIAPFLQEIGEAAKN
Sec Struct:HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT--SHHHHHHHHHHHHH
Associated ArchDB40 Subclass to 1gzs_B_104

SUBCLASS: HH-3.2.4