|
|
|
|
|
|
|
| Information on 1lj8_A_325 |
|
Loop code: 1lj8_A_325 PDB: 1lj8 Chain: A Type: HH alpha-alpha |
Loop Start: 325 Loop Length: 19 Sec Struct Nt length: 5 Sec Struct Ct length: 12 Structure geometry
|
| Sequence: | PLFVAYRAYDLDVTPNLAPVPGIDLTDYKQTLVDRF |
| Sec Struct: | HHHHH------SSGGG----TT--HHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | P - 325 | 1 | 0 |
| MSESELENOMETHIONINE | L - 326 | 1 | 0 |
| MSESELENOMETHIONINE | F - 327 | 1 | 0 |
| MSESELENOMETHIONINE | V - 328 | 0 | 1 |
| MSESELENOMETHIONINE | A - 329 | 0 | 1 |
| MSESELENOMETHIONINE | Y - 330 | 0 | 1 |
| MSESELENOMETHIONINE | D - 336 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|