|
|
|
|
|
|
|
| Information on 1n1b_A_317 |
|
Loop code: 1n1b_A_317 PDB: 1n1b Chain: A Type: HH alpha-alpha |
Loop Start: 317 Loop Length: 6 Sec Struct Nt length: 11 Sec Struct Ct length: 22 Structure geometry
|
| Sequence: | LVESFFWAVGMFEPHQHGYQRKMAATIIVLATVIDDIYD |
| Sec Struct: | HHHHHHHHHHH--STT-HHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| HGMERCURY (II) ION | L - 346 | 1 | 0 |
| HGMERCURY (II) ION | V - 349 | 1 | 0 |
| HGMERCURY (II) ION | I - 350 | 1 | 0 |
| MGMAGNESIUM ION | D - 351 | 1 | 0 |
| HGMERCURY (II) ION | I - 353 | 1 | 0 |
| MGMAGNESIUM ION | Y - 354 | 1 | 0 |
| MGMAGNESIUM ION | D - 355 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|