|
|
|
|
|
|
|
| Information on 1n1b_A_383 |
|
Loop code: 1n1b_A_383 PDB: 1n1b Chain: A Type: HH alpha-alpha |
Loop Start: 383 Loop Length: 4 Sec Struct Nt length: 25 Sec Struct Ct length: 24 Structure geometry
|
| Sequence: | YYMQLCYWGVHNYISDAAYDILKEHGFFCLQYLRKSVVDLVEAYFHEAKWYHS |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHHHHHS---HHHHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| HGMERCURY (II) ION | L - 387 | 1 | 0 |
| HGMERCURY (II) ION | C - 388 | 1 | 0 |
| HGMERCURY (II) ION | Y - 389 | 1 | 0 |
| HGMERCURY (II) ION | V - 392 | 1 | 0 |
| MGMAGNESIUM ION | Y - 426 | 1 | 0 |
| MGMAGNESIUM ION | E - 429 | 1 | 0 |
| Associated ArchDB95 Subclass to 1n1b_A_383 |
| For any comment or web-related incidence, send an email to the webmaster. |
|