Logo
Information on 1d2t_A_123
Loop code: 1d2t_A_123
PDB: 1d2t
Chain: A
Type: HH alpha-alpha
Loop Start: 123  Loop Length: 19
Sec Struct Nt length: 5  Sec Struct Ct length: 16
Structure geometry
d (Å): 19.310499 delta (°): 167.502304theta (°): 160.821503 rho (°): 232.892593
Sequence:PFAFYGVSTCNTQDKLSKNGSYPSGHTSIGWATALVLAEI
Sec Struct:HHHHHT---S-------SS--SS-HHHHHHHHHHHHHHHH