Logo
Information on 1ogl_A_223
Loop code: 1ogl_A_223
PDB: 1ogl
Chain: A
Type: HH alpha-alpha
Loop Start: 223  Loop Length: 13
Sec Struct Nt length: 9  Sec Struct Ct length: 15
Structure geometry
d (Å): 15.402900 delta (°): 45.464699theta (°): 142.918396 rho (°): 318.922211
Sequence:DNELLHECVQSVSVEDVLNEGTYLKAWEKIACSVFDA
Sec Struct:HHHHHHHHHTTS-TTTTT-TTTHHHHHHHHHHHHHHH