|
|
|
|
|
|
|
| Information on 1n1c_A_116 |
|
Loop code: 1n1c_A_116 PDB: 1n1c Chain: A Type: HH alpha-alpha |
Loop Start: 116 Loop Length: 21 Sec Struct Nt length: 6 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | EFLHQSKLQVQSHFPEPADHLAVLAYAHLCCH |
| Sec Struct: | HHHHHH------SS--GGGSTT-----HHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | E - 116 | 1 | 0 |
| MSESELENOMETHIONINE | F - 117 | 1 | 0 |
| MSESELENOMETHIONINE | L - 118 | 1 | 0 |
| MSESELENOMETHIONINE | H - 119 | 1 | 0 |
| MSESELENOMETHIONINE | A - 133 | 0 | 1 |
| MSESELENOMETHIONINE | D - 134 | 0 | 1 |
| MSESELENOMETHIONINE | H - 135 | 0 | 1 |
| MSESELENOMETHIONINE | L - 136 | 0 | 1 |
| MSESELENOMETHIONINE | A - 137 | 0 | 1 |
| MSESELENOMETHIONINE | V - 138 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|