Logo
Information on 1cx4_A_247
Loop code: 1cx4_A_247
PDB: 1cx4
Chain: A
Type: HH alpha-alpha
Loop Start: 247  Loop Length: 9
Sec Struct Nt length: 24  Sec Struct Ct length: 10
Structure geometry
d (Å): 7.582600 delta (°): 79.024101theta (°): 135.275299 rho (°): 288.593994
Sequence:RVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDV
Sec Struct:HHHHHHHHHHHHHHHHHHHHHHHHT-GGGTTS-HHHHHHHHHH