Logo
Information on 1v47_A_12
Loop code: 1v47_A_12
PDB: 1v47
Chain: A
Type: HH alpha-alpha
Loop Start: 12  Loop Length: 12
Sec Struct Nt length: 11  Sec Struct Ct length: 10
Structure geometry
d (Å): 18.853399 delta (°): 102.440804theta (°): 90.719002 rho (°): 358.375885
Sequence:EDERLDLENLATGAFFPVKGFMTREEALSVAHE
Sec Struct:HHHHHHHHHHHTTTTTT--SB--HHHHHHHHHH