Logo
Information on 1d8c_A_78
Loop code: 1d8c_A_78
PDB: 1d8c
Chain: A
Type: HH alpha-alpha
Loop Start: 78  Loop Length: 18
Sec Struct Nt length: 11  Sec Struct Ct length: 4
Structure geometry
d (Å): 39.810501 delta (°): 82.076500theta (°): 125.052002 rho (°): 218.078903
Sequence:KAAYKSFLRELGYLVPQPERVTVETTGIDSEIT
Sec Struct:HHHHHHHHHHHTSS----S----------HHHH