|
|
|
|
|
|
|
| Information on 7req_A_201 |
|
Loop code: 7req_A_201 PDB: 7req Chain: A Type: HH alpha-alpha |
Loop Start: 201 Loop Length: 8 Sec Struct Nt length: 5 Sec Struct Ct length: 18 Structure geometry
|
| Sequence: | LKEFMVRNTYIYPPQPSMRIISEIFAYTSAN |
| Sec Struct: | HHHHHTT----S-HHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| 2CP2-CARBOXYPROPYL-COENZYME A | K - 202 | 1 | 0 |
| B12COBALAMIN | M - 205 | 0 | 1 |
| B12COBALAMIN | V - 206 | 0 | 1 |
| 2CP2-CARBOXYPROPYL-COENZYME A | R - 207 | 0 | 1 |
| B12COBALAMIN | R - 207 | 0 | 1 |
| B12COBALAMIN | N - 208 | 0 | 1 |
| B12COBALAMIN | T - 209 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|