Logo
Information on 1s5p_A_85
Loop code: 1s5p_A_85
PDB: 1s5p
Chain: A
Type: HH alpha-alpha
Loop Start: 85  Loop Length: 8
Sec Struct Nt length: 15  Sec Struct Ct length: 13
Structure geometry
d (Å): 17.651800 delta (°): 51.693802theta (°): 75.765900 rho (°): 161.771103
Sequence:PELVQAFYNARRRQLQQPEIQPNAAHLALAKLQDAL
Sec Struct:HHHHHHHHHHHHHHHTSTT----HHHHHHHHHHHHH