|
|
|
|
|
|
|
| Information on 1m32_A_245 |
|
Loop code: 1m32_A_245 PDB: 1m32 Chain: A Type: HH alpha-alpha |
Loop Start: 245 Loop Length: 1 Sec Struct Nt length: 17 Sec Struct Ct length: 18 Structure geometry
|
| Sequence: | THTVLAFAQALKELAKEGGVAARHQRYQQNQRSLVA |
| Sec Struct: | HHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | H - 246 | 1 | 0 |
| MSESELENOMETHIONINE | T - 247 | 1 | 0 |
| MSESELENOMETHIONINE | L - 249 | 1 | 0 |
| MSESELENOMETHIONINE | A - 250 | 1 | 0 |
| MSESELENOMETHIONINE | V - 264 | 1 | 0 |
| MSESELENOMETHIONINE | S - 277 | 1 | 0 |
| MSESELENOMETHIONINE | L - 278 | 1 | 0 |
| MSESELENOMETHIONINE | V - 279 | 1 | 0 |
| MSESELENOMETHIONINE | A - 280 | 1 | 0 |
| Associated ArchDB40 Subclass to 1m32_A_245 |
| Associated ArchDB95 Subclass to 1m32_A_245 |
| For any comment or web-related incidence, send an email to the webmaster. |
|