Logo
Information on 2gsa_A_77
Loop code: 2gsa_A_77
PDB: 2gsa
Chain: A
Type: HH alpha-alpha
Loop Start: 77  Loop Length: 10
Sec Struct Nt length: 11  Sec Struct Ct length: 13
Structure geometry
d (Å): 13.772700 delta (°): 85.592598theta (°): 150.513794 rho (°): 100.520798
Sequence:PEVIEALKVAMEKGTSFGAPCALENVLAEMVNDA
Sec Struct:HHHHHHHHHHHTT-S--SS--HHHHHHHHHHHHH