Logo
Information on 1hhs_A_616
Loop code: 1hhs_A_616
PDB: 1hhs
Chain: A
Type: HH alpha-alpha
Loop Start: 616  Loop Length: 15
Sec Struct Nt length: 8  Sec Struct Ct length: 7
Structure geometry
d (Å): 14.425100 delta (°): 127.354500theta (°): 12.353800 rho (°): 319.978485
Sequence:PIDLEVLADPNKLQYKWTEADVSANIHEVL
Sec Struct:HHHHHHHH-GGGGGTT--GGGS-HHHHHHH