Logo
Information on 7a3h_A_60
Loop code: 7a3h_A_60
PDB: 7a3h
Chain: A
Type: EH beta-alpha
Loop Start: 60  Loop Length: 11
Sec Struct Nt length: 7  Sec Struct Ct length: 15
Structure geometry
d (Å): 9.769100 delta (°): 96.340401theta (°): 165.506500 rho (°): 196.074097
Sequence:VFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDL
Sec Struct:EEEEEEESSTTSTTT-TTHHHHHHHHHHHHHHH