|
|
|
|
|
|
|
| Information on 1r0p_A_1218 |
|
Loop code: 1r0p_A_1218 PDB: 1r0p Chain: A Type: EH beta-alpha |
Loop Start: 1218 Loop Length: 31 Sec Struct Nt length: 3 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | VKVADFGLARDMYDKEFDSVHNKTGAKLPVKWMALESLQT |
| Sec Struct: | EEE-SSGGG--TTTTT---TT-TT-SS--GGGS-HHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| KSAK-252A | L - 1225 | 0 | 1 |
| KSAK-252A | A - 1226 | 0 | 1 |
| KSAK-252A | R - 1227 | 0 | 1 |
| KSAK-252A | D - 1228 | 0 | 1 |
| KSAK-252A | M - 1229 | 0 | 1 |
| KSAK-252A | Y - 1230 | 0 | 1 |
| KSAK-252A | D - 1231 | 0 | 1 |
| KSAK-252A | K - 1232 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|