Logo
Information on 1pzd_A_722
Loop code: 1pzd_A_722
PDB: 1pzd
Chain: A
Type: HA beta-beta hairpin
Loop Start: 722  Loop Length: 12
Sec Struct Nt length: 13  Sec Struct Ct length: 6
Structure geometry
d (Å): 12.590800 delta (°): 128.387604theta (°): 132.283493 rho (°): 297.584595
Sequence:CTFSCVMKFTVKDCDPTTGEADDEGYEDEYV
Sec Struct:EEEEEEEEEEEEEB-TTT--B-S--EEEEEE