Logo
Information on 1xgs_A_197
Loop code: 1xgs_A_197
PDB: 1xgs
Chain: A
Type: EH beta-alpha
Loop Start: 197  Loop Length: 8
Sec Struct Nt length: 12  Sec Struct Ct length: 13
Structure geometry
d (Å): 19.658199 delta (°): 89.841499theta (°): 86.427902 rho (°): 221.932007
Sequence:VIEVPPTLIYMYVRDVPVRVAQARFLLAKIKRE
Sec Struct:EEEEEEEEEEEE------SSHHHHHHHHHHHHH