Logo
Information on 1c8u_A_99
Loop code: 1c8u_A_99
PDB: 1c8u
Chain: A
Type: EH beta-alpha
Loop Start: 99  Loop Length: 23
Sec Struct Nt length: 11  Sec Struct Ct length: 8
Structure geometry
d (Å): 34.544701 delta (°): 114.541702theta (°): 131.359695 rho (°): 92.199997
Sequence:KPIFYMTASFQAPEAGFEHQKTMPSAPAPDGLPSETQIAQSL
Sec Struct:EEEEEEEEEEE-----------------STT---HHHHHHHH