|
|
|
|
|
|
|
| Information on 1a77_*_74 |
|
Loop code: 1a77_*_74 PDB: 1a77 Chain: * Type: EH beta-alpha |
Loop Start: 74 Loop Length: 31 Sec Struct Nt length: 6 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | TPIWVFDGEPPKLKEKTRKVRREMKEKAELKMKEAIKKEDF |
| Sec Struct: | EEEEEE---TT----SS--SS-SSSSSSS-------SHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | D - 80 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|