Logo
Information on 1jez_A_108
Loop code: 1jez_A_108
PDB: 1jez
Chain: A
Type: EH beta-alpha
Loop Start: 108  Loop Length: 33
Sec Struct Nt length: 6  Sec Struct Ct length: 13
Structure geometry
d (Å): 11.404600 delta (°): 61.268700theta (°): 169.653305 rho (°): 17.011600
Sequence:VDLFLIHFPIAFKFVPIEEKYPPGFYCGDGNNFVYEDVPILETWKALEKLVA
Sec Struct:EEEEEE--S--B----TTT-SS-TT--SSTT---B----HHHHHHHHHHHHH