|
|
|
|
|
|
|
| Information on 1hjx_A_134 |
|
Loop code: 1hjx_A_134 PDB: 1hjx Chain: A Type: EH beta-alpha |
Loop Start: 134 Loop Length: 8 Sec Struct Nt length: 5 Sec Struct Ct length: 19 Structure geometry
|
| Sequence: | GLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEA |
| Sec Struct: | EEEEE-S---TT-HHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | Y - 141 | 0 | 1 |
| GOLGLYCEROL | K - 147 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| BC8 - GOL BINDING SITE FOR CHAIN A | Y - 141 | 0 | 1 |
| CC5 - GOL BINDING SITE FOR CHAIN A | K - 147 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|