|
|
|
|
|
|
|
| Information on 1qkn_A_279 |
|
Loop code: 1qkn_A_279 PDB: 1qkn Chain: A Type: HE alpha-beta |
Loop Start: 279 Loop Length: 5 Sec Struct Nt length: 24 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | LLDQVRLLESCWMEVLMVGLMWRSIDHPGKLIFA |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHHHHTTSTTEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| RALRALOXIFENE | W - 290 | 1 | 0 |
| RALRALOXIFENE | M - 291 | 1 | 0 |
| RALRALOXIFENE | L - 294 | 1 | 0 |
| RALRALOXIFENE | M - 295 | 1 | 0 |
| RALRALOXIFENE | G - 297 | 1 | 0 |
| RALRALOXIFENE | L - 298 | 1 | 0 |
| RALRALOXIFENE | R - 301 | 0 | 1 |
| RALRALOXIFENE | F - 311 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|