Information on 1gs4_A_730 |
Loop code: 1gs4_A_730 PDB: 1gs4 Chain: A Type: HE alpha-beta |
Loop Start: 730 Loop Length: 4 Sec Struct Nt length: 28 Sec Struct Ct length: 4 Structure geometry
|
Sequence: | VDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFA |
Sec Struct: | HHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSEEEE |
PDB ligands within a cut-off distance of 6 Å in this loop |
Ligands | Residue | atSS | atLOOP |
ZK59ALPHA-FLUOROCORTISOL | W - 741 | 1 | 0 |
ZK59ALPHA-FLUOROCORTISOL | M - 742 | 1 | 0 |
ZK59ALPHA-FLUOROCORTISOL | M - 745 | 1 | 0 |
ZK59ALPHA-FLUOROCORTISOL | V - 746 | 1 | 0 |
ZK59ALPHA-FLUOROCORTISOL | M - 749 | 1 | 0 |
ZK59ALPHA-FLUOROCORTISOL | R - 752 | 1 | 0 |
ZK59ALPHA-FLUOROCORTISOL | Y - 763 | 1 | 0 |
ZK59ALPHA-FLUOROCORTISOL | F - 764 | 1 | 0 |
ZK59ALPHA-FLUOROCORTISOL | A - 765 | 1 | 0 |
PDB Site Annotation |
Site | Residue | atSS | atLOOP |
AC1ZK5 BINDING SITE FOR CHAIN A | R - 752 | 1 | 0 |
Associated ArchDB95 Subclass to 1gs4_A_730 |